
European Learning Laboratory for the Life Sciences
Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.
In this part of the activity, we will feed two of the protein sequences which we have generated in the previous step into the EMBL-EBI MUSCLE alignment tool to check the similarity between these two fluorescent proteins. A sequence alignment based on the amino acid sequence gives a stronger hint towards their similarity than a nucleotide sequence. The alignment allows us to visualise additions, deletions or exchanges within the amino acid sequences. It also allows to find amino acid residues or stretches which have been strongly conserved during evolution.
After completing this task, you will have produced a multiple sequence alignment on protein level and you will be able to roughly estimate where and what the differences between our two sequences are.
Proceed as described below:
>Protein_Sequence1_AVGFP_1
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
>Protein_Sequence2_GFPm_1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Have a look at the protein alignment and try to answer the following questions:
Share: