ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Français,  Ελληνικά,  Italiano and  Svenska

Krok 4: Srovnání aminokyselinových sekvencí

Úvod

V této části použijeme dvě sekvence z předchozí části k určení podobnosti těchto sekvencí za pomoci  nástroje EBI MUSCLE, který slouží ke srovnávání sekvencí. Sekvenční srovnávání proteinových sekvencí je silnější indicíí podobností sekvencí než sekvenční srovnání založené na podobnosti nukleotidových sekvencí. saekvenční srovnávání nám umožnuje zobrazit inzerce, delece a mutace, ke kterým muselo dojít u obou sekvencí na cestě od společného předka obou sekvencí. Sekvenční srovnávání nám dále umožňuje také identifikovat aminokyseliny, které byly během evoluce dobře konzervovány.

Na závěr této části budete mít k dispozici sekvenční srovnávání na jehož základě budete moci hrubě odhadnout hlavní rozdíly mezi oběma sekvencemi.

Váš úkol

Pokračujte dle následujících instrukcí:

  1. Zkopírujte všechny sekvence z tabulátoru “Aminokyselinové sekvence” (Ctrl+C).
  2. Vložte zkopírované sekvence do nástroje Muscle EBI (Ctrl+V).
  3. Následujte instrukce v tabulátoru Muscle.
  4. Podívejte se ná výsledek a pokuste se zodpovědět přiložené otázky.

MUSCLE

  1. Zkopírujte všechny sekvence z tabulátoru “Aminokyselinové sekvence” (Ctrl+C).
  2. Vložte zkopírované sekvence do nástroje Muscle EBI (Ctrl+V).
  3. V části “STEP 2” se přesvědčte, že “Output Format/ výstupní formát” je nastaven na Clustal W.
  4. Označte tlačítko “Submit/Odešlete” a sekvenční srovnávání bude zpracováno.
  5. Výsledky se brzy objeví.
  6. Podívejte se ná výsledek a pokuste se zodpovědět přiložené otázky.

Aminokyselinové sekvence

Protein sequence 1
>Protein_Sequence1_AVGFP_1
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
Protein sequence 2
>Protein_Sequence2_GFPm_1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Otázky

Podívejte se na výsledné sekvenční srovnávání a zodpovězte následující otázky:

  • Jak poznáte kdy jsou na dané pozici stejné aminokyseliny a kdy nejsou sekvence srovnány?
  • Je  tam mnoho korespondujících aminokyselin? Obsahuje proteinové sekvenční srovnávání více podobností než nukleotidové sekvenční srovnávání?
  • Co způsobuje rozdíly mezi nukleotidovým a aminokyselinovým sekvenčním srovnáváním?

Navigace aktivity

Honba za pokladem – GFP

Share: