ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Čeština,  Français,  Ελληνικά and  Svenska

Step 4: Confronto di sequenze aminoacidiche

Descrizione

In questa parte dell’attività, inseriremo due delle sequenze proteiche ottenute nella fase precedente nello strumento di allineamento EMBL-EBI MUSCLE per individuare le somiglianze tra queste due proteine fluorescenti. Un allineamento basato sulle sequenze aminoacidiche dà informazioni più attendibili rispetto alle sequenze nucleotidiche. L’allineamento consente di visualizzare addizioni, delezioni o scambi all’interno delle seuqnze aminoacidiche. Ci consente inoltre di individuare residui aminoacidici o sequenze che sono state fortemente conservate nel corso dell’evoluzione.

Dopo aver portato a termine questo compito, avrete prodotto un allineamento di sequenze multiple a livello di proteina e sarete in grado di stimare approssimativamente dove e quali sono le differenze tra le due sequenze.

Il tuo compito

  1. Copiate tutte le sequenze aminoacidiche fornite nella tabulazione “Amino acid sequences” (cioè selezionate e copiate l’intero blocco di sequenza) (comando Ctrl. + C).
  2. Incollate le sequenze aminoacidiche nel box di ricerca MUSCLE (comandot Ctrl. + V).
  3. Seguite le istruzioni nella tabulazione “MUSCLE” per allineare le vostre sequenze.
  4. Osservate l’allineamento e cercate di rispondere alle domande.

MUSCLE

  1. Copiate tutte le sequenze aminoacidiche fornite nella tabulazione “Amino acid sequences” (cioè selezionate e copiate l’intero blocco di sequenza) (comando Ctrl. + C).
  2. Incollate le sequenze aminoacidiche nel box di ricerca MUSCLE (comandot Ctrl. + V).
  3. Nella sezione “STEP 2″ assicuratevi che”Output Format” sia su “ClustalW”.
  4. Cliccate sul bottone “Submit” e il vostro allineamento sarà processato.
  5. Il risultato apparirà dopo pochi secondi.
  6. Osservate l’allineamento e cercate di rispondere alle domande nella tabulazione “Questions”.

Amino acid sequences

Protein sequence 1
>Protein_Sequence1_AVGFP_1
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
Protein sequence 2
>Protein_Sequence2_GFPm_1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Domande

Osservate l’allineamento e cercate di rispondere alle domande seguenti:

  • Come possiamo sapere se i residui aminoacidici delle singole sequenze sono uguali o diversi rispetto a quelli delle altre sequenze allineate?
  • Pensate che ci siano molti aminoacidi che si corrispondono? Ci sono più somiglianze rispetto ai relativi allineamenti nucleotidici?
  • Quali pensate possano essere i motivi di questi cambiamenti?

Liste attivita

Caccia al tesoro GFP

Share: