ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Čeština,  Ελληνικά,  Italiano and  Svenska

Étape 4 : Comparaison des séquences d’acides aminés

Aperçu

Dans cette partie de l’activité, nous insérerons deux des séquences de protéines que vous avons déjà produites à l’étape précédente dans l’outil d’alignement EMBL-EBI MUSCLE, afin de vérifier s’il existe des similarités entre ces deux protéines fluorescentes. Un alignement de séquence basé sur la séquence d’acides aminés donne plus d’indices quant à leur similarité qu’une séquence de nucléotide. L’alignement nous permet de visualiser les additions, les suppressions ou les échanges à l’intérieur des séquences d’acides aminés. Il nous permet aussi de trouver des résidus d’acides aminés ou des segments qui ont été fortement conservés pendant son évolution.

À la fin de cette tâche, vous aurez produit un alignement de séquences multiples au niveau de la protéine et vous serez en mesure d’estimer grossièrement la nature et l’emplacement des différences entre les deux séquences.

Votre tâche

Suivez la procédure suivante :

  1. Copiez toutes les séquences d’acides aminés qui sont disponibles sous l’onglet “Séquences d’acides aminés” (par ex. sélectionnez et copiez le bloc complet des séquences) (vous pouvez utiliser le raccourci clavier : Ctrl + C).
  2. Collez la séquences d’acides aminés dans la zone de recherche MUSCLE (vous pouvez utiliser le raccourci clavier Ctrl + V).
  3. Suivez les instructions sous l’onglet “MUSCLE” pour aligner vos séquences.
  4. Observez l’alignement ainsi produit et essayez de répondre aux questions relatives à la tâche.

MUSCLE

  1. Copiez toutes les séquences d’acides aminés qui sont disponibles sous l’onglet “Séquences d’acides aminés” (par ex. sélectionnez et copiez le bloc complet des séquences) (vous pouvez utiliser le raccourci clavier Ctrl + C).
  2. Collez la séquence d’acides aminés dans la zone de recherche MUSCLE (vous pouvez utiliser le raccourci clavier Ctrl + V).
  3. Dans la section “Étape 2”, assurez-vous que le “Format de sortie” correspond à “ClustalW”.
  4. Cliquez simplement sur le gros bouton “Envoyer” et votre alignement sera traité.
  5. Vous pourrez voir le résultat en quelques secondes.
  6. Observez l’alignement et essayez de répondre aux questions sous l’onglet “Questions”.

Séquences d’acides aminés

Protein sequence 1
>Protein_Sequence1_AVGFP_1
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
Protein sequence 2
>Protein_Sequence2_GFPm_1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Questions

Observez l’alignement de la protéine et essayez de répondre aux questions suivantes :

  • Comment pouvez-vous savoir si les résidus d’acides aminés des séquences individuelles sont identiques ou non aux autres alignements de séquences ?
  • Croyez-vous qu’il y ait plusieurs acides aminés correspondants ? Y a-t-il plus de similarités comparativement aux alignements des nucléotides respectifs ?
  • Quelles sont les raisons de ces différences ?

Navigation d’activité

Chasse au trésor GFP

Share: