ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Čeština,  Français,  Ελληνικά and  Italiano

Steg 4: Jämförelse av aminosyrasekvenser

Översikt

I den här delen av aktiviteten ska vi ladda två av proteinsekvenserna, som vi har genererat i det föregående steget, till EMBL-EBI MUSCLE alignment redskapet för att undersöka likheten mellan dessa två fluorescerande proteiner. En “sequence alignment” baserad på aminosyrasekvenser ger en starkare antydan av deras likheter jämfört med en nukleotidsekvens. Denna “alignment” låter oss visualisera mutationer såsom addition, deletion eller utbyte inom aminosyrasekvenserna. Vi kan också finna aminosyrarester eller sträckor som har konserverats starkt under evolutionen.

Efter att ha genomfört den här uppgiften så har du producerat en “multiple sequence alignment” på proteinnivå och du kommer att grovt kunna uppskatta var och vad skillnaderna mellan våra två sekvenser är.

Din uppgift

Fortsätt som beskrivs nedan

  1. Kopiera alla aminosyrasekvenser som erhålls under fliken “Aminosyrasekvenser” (med andra ord markera och kopiera hela stycket med sekvenser) (genväg Ctrl. + C).
  2. Klistra in aminosyrasekvenserna i sökrutan i MUSCLE (genväg Ctrl. + V).
  3. Följ instruktionerna under fliken “MUSCLE” för att “aligna” dina sekvenser.
  4. Studera din “alignment” och försök besvara frågorna.

MUSCLE

  1. Kopiera alla aminosyrasekvenser som erhålls under fliken “Aminosyrasekvenser” (med andra ord markera och kopiera hela stycket med sekvenser) (genväg Ctrl. + C).
  2. Klistra in aminosyrasekvenserna i sökrutan i MUSCLE (genväg Ctrl. + V).
  3. I “STEP 2” sektionen kolla att “Output Format” är markerat vid “ClustalW”.
  4. Klicka på den stora “Submit” knappen och din “alignment” kommer att behandlas.
  5. Du ser resultatet efter några sekunder.
  6. Studera din “alignment” och försök besvara frågorna i “Frågor” fliken.

Aminosyrasekvenser

Protein sequence 1
>Protein_Sequence1_AVGFP_1
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
Protein sequence 2
>Protein_Sequence2_GFPm_1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Frågor

Studera din protein “alignment” och försök besvara följande frågor:

  • Hur vet du om aminosyrresterna i de enskilda sekvenserna är desamma eller ej, jämfört med de andra “alignade” sekvenserna?
  • Tycker du att det är många motsvarande aminosyror? Är det fler likheter jämfört med respektive nukleotid “alignment”?
  • Vad tror du orsakerna är till dessa förändringar?

Aktivitetsnavigering

GFP skattjakt

Share: