ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Čeština,  Français,  Italiano and  Svenska

Βήμα 4: Σύγκριση αμινοξικών αλληλουχιών

ΣΦΑΙΡΙΚΗ ΕΙΚΟΝΑ

Σε αυτό το μέρος της δραστηριότητας, θα εισάγεις δύο από τις πρωτεϊνικές αλληλουχίες που παρήγαγες στο προηγούμενο βήμα στο εργαλείο ευθυγράμμισης αλληλουχιών του EMBL-EBI που ονομάζεται MUSCLE alignment tool, ώστε να ελέγξεις την ομοιότητα μεταξύ των δύο φθοριζουσών πρωτεϊνών. Η ευθυγράμμιση μεταξύ των αμινοξικών αλληλουχιών παρέχει πιο ισχυρή ένδειξη γα την ομοιότητά τους από ότι η ευθυγράμμιση μεταξύ των νουκλεοτιδικών αλληλουχιών. Η ευθυγράμμιση επιτρέπει την οπτικοποίηση των σημειακών μεταλλαγών που μπορεί να συμβούν στην αμινοξική αλληλουχία, όπως για παράδειγμα προσθήκες, ελλείψεις ή αντικαταστάσεις αμινοξέων. Επιπλέον επιτρέπει τον εντοπισμό αμινοξικών καταλοίπων ή περιοχών οι οποίες έχουν συντηρηθεί σε αυτές τις θέσεις κατά τη διάρκεια της εξέλιξης.

Όταν ολοκληρώσεις αυτό το μέρος της δραστηριότητας, θα έχεις παράξει μια πολλαπλή ευθυγράμμιση αλληλουχιών σε πρωτεϊνικό επίπεδο και θα είσαι σε θέση να εκτιμήσεις τόσο τη θέση, όσο και το είδος των διαφορών μεταξύ των δύο αλληλουχιών.

Η εργασία σου

Προχώρησε όπως περιγράφεται παρακάτω:

  1. Κάνε αντιγραφή όλων των αμινοξικών αλληλουχιών που παρέχονται στο πεδίο “Αμινοξικές αλληλουχίες” (για παράδειγμα επίλεξε και αντίγραψε όλες τις αλληλουχίες μαζί χρησιμοποιώντας τα πλήκτρα Ctrl. + C για συντομία).
  2. Επικόλλησε τις αμινοξικές αλληλουχίες στο πεδίο αναζήτησης του εργαλείου MUSCLE. (Μπορείς να χρησιμοποιήσεις τα πλήκτρα Ctrl. + V για συντομία).
  3. Ακολούθησε τις οδηγίες στο πεδίο “MUSCLE” για να ευθυγραμμίσεις τις αλληλουχίες.
  4. Παρατήρησε την ευθυγράμμιση αλληλουχιών που σου επέστρεψε το εργαλείο αυτό και προσπάθησε να απαντήσεις τις ερωτήσεις στο αντίστοιχο πεδίο.

Εργαλείο MUSCLE

  1. Κάνε αντιγραφή όλων των αμινοξικών αλληλουχιών που παρέχονται στο πεδίο “Αμινοξικές αλληλουχίες” (για παράδειγμα επίλεξε και αντίγραψε όλες τις αλληλουχίες μαζί χρησιμοποιώντας τα πλήκτρα Ctrl. + C για συντομία)
  2. Επικόλλησε τις αμινοξικές αλληλουχίες στο πεδίο αναζήτησης του εργαλείου MUSCLE. (Μπορείς να χρησιμοποιήσεις τα πλήκτρα Ctrl. + V για συντομία).
  3. Στο Βήμα 2 ή “STEP 2” έλεγξε αν το “Output Format” είναι ρυθμισμένο στο “ClustalW”.
  4. Κάνε κλικ στο κουμπί “Submit” και θα ξεκινήσει η ευθυγράμμιση των αλληλουχιών που εισήγαγες.
  5. Θα δεις τα αποτελέσματα μετά από μερικά δευτερόλεπτα.
  6. Παρατήρησε την αλληλουχία και προσπάθησε να απαντήσεις τις ερωτήσεις στο αντίστοιχο πεδίο.

Αμινοξικές αλληλουχίες

Protein sequence 1
>Protein_Sequence1_AVGFP_1
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK
Protein sequence 2
>Protein_Sequence2_GFPm_1
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Ερωτήσεις

Παρατήρησε την ευθυγράμμιση των πρωτεϊνικών αλληλουχιών και προσπάθησε να απαντήσεις τις παρακάτω ερωτήσεις:

  • Πως μπορείς να ελέγξεις αν τα αμινοξικά κατάλοιπα κάθε αλληλουχίας είναι όμοια ή όχι σε σύγκριση με αυτά των υπολοίπων αλληλουχιών;
  • Υπάρχουν αρκετές ομοιότητες μεταξύ των αμινοξέων των διαφορετικών αλληλουχιών; Αυτές οι ομοιότητες είναι περισσότερες, λιγότερες ή ίδιες σε σχέση με αυτές που εντόπισες κατά την ευθυγράμμιση των νουκλεοτιδικών αλληλουχιών;
  • Ποιοι νομίζεις ότι είναι οι λόγοι για αυτές τις διαφορές;

Πλοήγηση δραστηριότητας

Κυνήγι θησαυρού της πράσινης φθορίζουσας πρωτεΐνης – GFP

Share: