ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Čeština,  Français and  Ελληνικά

Parte 1: Ricerca per identità di proteine

Descrizione

Immaginiamo di aver clonato un nuovo gene e di aver appena ottenuto il risultato del sequenziamento. Siamo stati in grado di tradurre la sequenza nucleotidica in una sequenza amminoacidica. Tuttavia, non sappiamo nulla riguardo alla funzione del nostro gene. Cercheremo quindi di trovare sequenze molto simili in una banca dati di sequenze di proteine note per vedere se la nostra proteina somigli a qualche sequenza nota e quale sia la sua funzione.

Per iniziare l’attività, segui le istruzioni nella sezione “Compito” e cerca di rispondere alle domande dell’attività.

Compito

Procedi secondo le seguenti istruzioni:

1. La sezione “Sequenza” contiene la sequenza amminoacidica di una proteina bovina sconosciuta “Bovine_Protein”.
2. Copia la sequenza e segui le istruzioni riportate nella sezione “Protein BLAST” per avviare una ricerca che ti consenta di identificare la proteina.
3. Segui le istruzioni della sezione “protein BLAST” e poi cerca di rispondere alle domande presenti nella sezione “Domande”.

Sequenza

La tua sequenza iniziale:

Bovine_Protein
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Protein BLAST

1. Accedi allo strumento Protein BLAST (Basic Local Alignment Search Tool) qui sotto.
2. Incolla la tua sequenza di amminoacidi (inclusi il simbolo maggiore e il nome della sequenza) nella finestra di ricerca (query box). Fornisci un titolo per la tua ricerca (job title). Accertati che nella sezione parametri (Parameters) sia selezionato “blastp”. Avvia la ricerca cliccando su “Submit”
3. Guarda la tabella dei risultati ottenuti e cerca di rispondere alle domande della sezione “Domande”.

Domande

1. Quale proteina della banca dati ha il più alto valore di similarità con la tua?
2.
Che percentuale di identità c’è fra la tua proteina sconosciuta e il miglior risultato della ricerca?
3.
Qual è la funzione biologica nota della proteina più simile alla tua? (clicca sul link nella seconda colonna della tabella dei risultati (DB:IB) e scorri fino a “General annotation (Comments)”).

Lista attivitá

Share: