ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Français,  Ελληνικά and  Italiano

Část 1: Hledání identity neznámého proteinu

Overview

Právě se nám podařilo vyklonovat nový gen a dnes jsme konečně získali výsledky sekvenační reakce. Podařilo se nám přeložit DNA sekvenci do proteinové, bohužel však nevíme nic o funkci tohoto genu. Proto se pokusíme v internetové bioinformatické databázi, která již obsahuje mnoho známých proteinů, najít velmi podobné sekvence a zjistit, jestli se náš protein nápadně nepodobá některému proteinu, jehož biologická funkce je již známa.

Při vypracovávání úlohy prosím sledujte pokyny v záložce “Vaše úloha” a pokuste se odpovědět na otázky ke každému cvičení.

Vaše úloha

Postupujte následovně:

1. Záložka “Sekvence” obsahuje aminokyselinovou sekvenci našeho nově vyklonovaného neznámého proteinu “Bovine_Protein”. (tedy alespoň víme, že jsme gen vyklonovali z býka).
2. Zkopírujte sekvenci do paměti počítače a pokračujte záložkou “Protein BLAST”.
3. Řiďte se pokyny v záložce “Protein BLAST” a pokuste se odpovědět na otázky v záložce “Otázky”.

Sekvence

Aše vstupní sekvence (“neznámý” protein):

Bovine_Protein
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Protein BLAST

1. Použijte níže zobrazený nástroj Protein BLAST (Basic Local Alignment Search Tool).
2.
Zkopírujte a vložte vaší aminokyselinovou sekvenci (včetně znaménka “>”) do okna “Query”. Poté můžete vložit krátký popis (např. “neznámý protein”). Zkontrolujte, jestli je v políčku “Parameters” zatržena možnost “blastp” a kliknutím na “Submit” odešlete váš “job” ke zpracování na serveru.
3.
Jakmile obdržíte výsledky, projděte je a pokuste se zodpovědět na Otázky k úloze.

Otázky k úloze

1. Který protein v databázi vykazuje nejlepší “hit” k vašemu neznámému proteinu?
2.
Na kolik procent je tento nejlepší hit identický vašemu proteinu?
3.
Jaká je biologická funkce tohoto nejpodobnějšího proteinu? (V tabulce výsledků klikněte na odkaz v druhém sloupci (DB:ID) a prohlédněte si informace v políčku “General annotation (Comments)”.)

Activity navigation

Share: