ELLS

European Learning Laboratory for the Life Sciences

Our inspiring educational experiences share the scientific discoveries of EMBL with young learners aged 10-19 years and teachers in Europe and beyond.

This article is also available in  English,  Čeština,  Français and  Italiano

Μέρος 1ο: Ταυτοποίηση της πρωτεΐνης

Overview

Φαντάσου ότι έχουμε κλωνοποιήσει ένα νέο γονίδιο και πρόσφατα λάβαμε τα αποτελέσματα της αλληλούχησής του. Είμαστε σε θέση να μεταφράσουμε τη νουκλεοτιδική αλληλουχία σε αλληλουχία αμινοξέων. Παρόλα αυτά, δε γνωρίζουμε τίποτα για τη λειτουργία αυτού του γονιδίου. Θα προσπαθήσουμε, λοιπόν, να εντοπίσουμε γνωστές πρωτεϊνικές αλληλουχίες στη βάση δεδομένων για να διαπιστώσουμε αν η πρωτεΐνη μας μοιάζει με κάποια από αυτές τις γνώστες αλληλουχίες των οποίων γνωρίζουμε τις λειτουργίες.

Για να ξεκινήσεις τη δραστηριότητα, απλά ακολούθησε τις οδηγίες στο πεδίο “Η εργασία μου” και προσπάθησε να απαντήσεις στις ερωτήσεις.

Η εργασία μου

Προχώρησε όπως περιγράφεται παρακάτω:

1. Το πεδίο “Αλληλουχία” περιέχει την αλληλουχία αμινοξέων της άγνωστης πρωτεΐνης “Βόεια_Πρωτεΐνη”.
2. Κάνε αντιγραφή της αλληλουχίας και ακολούθησε τις οδηγίες στο πεδίο “Protein BLAST” για να αναζητήσεις την ταυτότητα αυτής της πρωτεΐνης.
3. Ακολούθησε τις οδηγίες στο πεδίο “Protein BLAST” για να απαντήσεις τις ερωτήσεις στο αντίστοιχο πεδίο.

Αλληλουχία

Η αλληλουχία σου:

Bovine_Protein
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Protein BLAST

1. Μπορείς να αποκτήσεις πρόσβαση στο εργαλείο Protein BLAST (Basic Local Alignment Search Tool) παρακάτω.
2.
Επικόλλησε την αλληλουχία αμινοξέων (συμπεριλαμβανομένου του συμβόλου > και του ονόματος της αλληλουχίας στο πεδίο υποβολής αιτήματος). Εισήγαγε έναν περιγραφικό τίτλο για την εργασία σου (όπως “Άγνωστη Πρωτεΐνη”). Στο πεδίο “Parameters” βεβαιώσου ότι το “blastp” έχει επιλεγεί. Ξεκίνησε την αναζήτηση με το πλήκτρο “Submit”.
3.
Κοιτώντας στον πίνακα δεδομένων, προσπάθησε να απαντήσεις τις ερωτήσεις.

Ερωτήσεις

1. Ποια πρωτεΐνη δίνει τη μεγαλύτερη ομοιότητα (το καλύτερο αποτέλεσμα) στην πρωτεϊνική βάση δεδομένων;
2.
Ποιο ποσοστό ομοιότητας έχει η δική σου “Άγνωστη Πρωτεΐνη” με αυτή που σου επέστρεψε το εργαλείο ως το καλύτερο αποτέλεσμα;
3.
Ποια είναι η γνωστή βιολογική λειτουργία της πρωτεΐνης που σου επέστρεψε το εργαλείο; (Κάνε κλικ στο σύνδεσμο στη δεύτερη στήλη του πίνακα αποτελεσμάτων και εντόπισε το πεδίο “General annotation (Comments)”.)

Activity navigation

Share: